missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ARIH2 (aa 368-489) Control Fragment Recombinant Protein

Product Code. 30194699
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194699

Brand: Invitrogen™ RP107565

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. May play a role in myelopoiesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95376
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10425
Name Human ARIH2 (aa 368-489) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI843547; all-trans retinoic acid inducible RING finger; ARI2; ARI-2; ariadne 2; ariadne homolog 2; ariadne homolog 2 (Drosophila); ariadne RBR E3 ubiquitin protein ligase 2; ARIH2; E3 ubiquitin-protein ligase ARIH2; FLJ10938; FLJ33921; HT005; OTTHUMP00000210388; protein ariadne-2 homolog; Protein ariadne-2-like protein-like protein; RING-type E3 ubiquitin transferase ARIH2; Triad1; Triad1 protein; UbcM4-interacting protein 48; Uip48
Common Name ARIH2
Gene Symbol Arih2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.