missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16087696

Abnova™ Human ATOX1 (NP_004036.1) Full-length Recombinant Protein expressed in yeast

Product Code. 16087696
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
This item is not returnable. View return policy

Product Code. 16087696

Brand: Abnova™ P3737.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for SDS-PAGE

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq]

Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Specifications

Accession Number NP_004036.1
For Use With (Application) SDS-PAGE
Formulation In 50mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30mM Glutathione, 0.5% TritonX-100, 1mM dithiothreitol)
Gene ID (Entrez) 475
Molecular Weight (g/mol) 7.39kDa
Name ATOX1 (Human) Recombinant Protein
Preparation Method Yeast expression system
Purification Method Affinity Purification
Quantity 100 μg
Storage Requirements Store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias ATX1/HAH1/MGC138453/MGC138455
Common Name ATOX1
Gene Symbol ATOX1
Species Yeast
Recombinant Recombinant
Protein Tag None
Expression System Yeast expression system
Form Liquid
Purity or Quality Grade 0.9
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.