missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP Synthase beta (aa 50-191) Control Fragment Recombinant Protein

Product Code. 30212007
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212007

Brand: Invitrogen™ RP100510

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81950 (PA5-81950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP synthase is extremely conserved through evolution and can be found in plants, fungi, bacteria, and animals. The ATP synthase enzyme is a transmembrane protein responsible for driving the reversible reaction from ADP+ phosphate to ATP. This reaction is accomplished by a flux of protons across the membrane as a result of electron transfer. The ATP synthase protein has two main sections; the F1 ATP-ase (soluble) and the F0 ATP-ase (membrane embedded). The F1 section consists of the alpha, beta, gamma, delta, and epsilon subunits. While the F0 consists of a, b, and c subunits.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P06576
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 506
Name Human ATP Synthase beta (aa 50-191) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ATP synthase F1 subunit beta; ATP synthase subunit beta, mitochondrial; ATP synthase, H+ transporting mitochondrial F1 complex, alpha subunit; ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; Atp5b; ATP5F1B; ATPMB; ATPSB; beta-subunit; epididymis secretory protein Li 271; f1-ATPase beta; F1-ATPase beta-subunit; F-1-ATPase beta-subunit precursor; fj13e04; fj55c09; HEL-S-271; hm:zehn0534; hypothetical protein LOC554135; im:6793121; MGC5231; mitochondrial ATP synthase beta subunit; mitochondrial ATP synthase subunit beta subunit; mitochondrial ATP synthase, H+ transporting F1 complex beta subunit; mitochondrial ATP synthetase, beta subunit; wu:fj13e04; wu:fj38d01; wu:fj55c09; zgc:111961
Common Name ATP Synthase beta
Gene Symbol ATP5F1B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.