missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP1A3 (aa 28-60) Control Fragment Recombinant Protein

Product Code. 30197743
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30197743 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30197743 Supplier Invitrogen™ Supplier No. RP103256

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84291 (PA5-84291. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The sodium/potassium ATPase is an integral membrane enzyme found in all cells of higher organisms and is responsible for the ATP-dependent transport of sodium and potassium across the cell membrane. This membrane-bound enzyme is related to a number of other ATPases including sarcoplasmic and endoplasmic reticulum calcium ATPase (SERCA) and plasma membrane calcium ATPase (PMCA). The sodium/potassium ATPase consists of a large, multipass, transmembrane catalytic subunit, termed the alpha subunit, and an associated smaller glycoprotein, termed the beta subunit. Studies indicate that there are three isoforms of the alpha subunit (alpha 1, alpha 2, alpha 3) and two isoforms of the beta subunit (beta 1 and beta 2) encoded by two multigene families. The different isoforms of the sodium/potassium ATPase exhibit tissue-specific and developmental patterns of expression. The alpha 1 and beta mRNAs are present in all cell types examined, whereas the alpha 2 and alpha 3 mRNAs exhibit a more restricted pattern of cell-specific expression. The alpha-3 subunit has been found in neuronal and to skeletal and cardiac muscle, lung and stomach tissues.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P13637
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 478
Name Human ATP1A3 (aa 28-60) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AHC2; ATP1A1; Atp1a3; ATPa1a3; Atpa-2; ATPase Na+/K+ transporting subunit alpha 3; ATPase, Na+/K+ transporting, alpha 3 polypeptide; ATPase, Na+K+ transporting, alpha 3 subunit; CAPOS; DYT12; EC 3.6.3.9; Na(+)/K(+) ATPase alpha(III) subunit; Na(+)/K(+) ATPase alpha-3 subunit; Na+, K+ activated adenosine triphosphatase alpha subunit; Na+/K+ ATPase 3; Na+/K+ -ATPase alpha 3 subunit; RDP; Sodium Potassium ATPase; Sodium pump 3; sodium pump subunit alpha-3; sodium/potassium-transporting ATPase alpha-3 chain; sodium/potassium-transporting ATPase subunit alpha-3; sodium-potassium ATPase catalytic subunit alpha-3; sodium-potassium-ATPase, alpha 3 polypeptide
Common Name ATP1A3
Gene Symbol ATP1A3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.