missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207387

Invitrogen™ Human ATP1B1 (aa 62-207) Control Fragment Recombinant Protein

Product Code. 30207387
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207387

Brand: Invitrogen™ RP90297

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82474 (PA5-82474. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P05026
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 481
Name Human ATP1B1 (aa 62-207) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias adenosinetriphosphatase; ATP1B; ATP1B1; Atp4b; ATPase beta subunit; ATPase Na+/K+ transporting subunit beta 1; ATPase, Na+/K+ transporting, beta 1 polypeptide; Atpb; Atpb-1; ATPBS; Beta 1-subunit of Na(+),K(+)-ATPase; hypothetical protein LOC519758; MGC1798; Na, K-ATPase beta-1 polypeptide; Na,K-ATPase beta 1 subunit; Na+, K+-ATPase; Na+, K+-ATPase beta-subunit; Na+,K+-ATPase beta 1 subunit; Na+/K+ ATPase Beta; NKbeta1; OTTHUMP00000032537; OTTHUMP00000032538; P-type ATPase; Sodium Potassium ATPase; sodium pump subunit beta-1; sodium/potassium ATPase beta subunit; sodium/potassium-dependent ATPase beta-1 subunit; sodium/potassium-dependent ATPase subunit beta-1; sodium/potassium-transporting ATPase beta-1 chain; sodium/potassium-transporting ATPase subunit beta-1; sodium-potassium ATPase subunit beta 1 (non-catalytic); unnamed protein product
Common Name ATP1B1
Gene Symbol ATP1B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.