missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP5G2 (aa 39-117) Control Fragment Recombinant Protein

Product Code. 30205090
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205090

Brand: Invitrogen™ RP101288

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62413 (PA5-62413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP5G2, also named as ATPase protein 9 and ATPase subunit c, belongs to the ATPase C chain family. Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. ATP5G2 is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q06055
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 517
Name Human ATP5G2 (aa 39-117) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810041M08Rik; ATP synthase c subunit; ATP synthase F(0) complex subunit C2, mitochondrial; ATP synthase lipid-binding protein; ATP synthase lipid-binding protein, mitochondrial; ATP synthase membrane subunit c locus 2; ATP synthase proteolipid P2; ATP synthase proton-transporting mitochondrial F(0) complex subunit C2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial Fo complex subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9); ATP5A; ATP5G2; Atp5mc2; ATPase protein 9; ATPase subunit c; mitochondrial ATP synthase, subunit C (subunit 9), isoform 2; PSEC0033
Common Name ATP5G2
Gene Symbol ATP5MC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.