missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202514

Invitrogen™ Human AVEN (aa 263-346) Control Fragment Recombinant Protein

Product Code. 30202514
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202514

Brand: Invitrogen™ RP92081

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82735 (PA5-82735. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apoptosis plays a major role in normal organism development, tissue homeostasis, and removal of damaged cells. Disruption of this process has been implicated in a variety of diseases such as cancer. Aven is a recently discovered protein that blocks apoptosis induced by Apaf-1 and caspase-9. It is thought that Aven functions by binding to Bcl-xL, an antiapoptotic member of the Bcl-2 family, and to Apaf-1, possibly interfering with the ability of Apaf-1 to self-associate, suggesting that Aven impedes Apaf-1-mediated caspase activation. Higher levels of Aven mRNA are seen in patients with acute leukemia than in control patients, suggesting that Aven may be useful as a prognostic indicator in leukemia patients.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQS1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57099
Name Human AVEN (aa 263-346) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700013A01Rik; 1700056A21Rik; apoptosis and caspase activation inhibitor; apoptosis, caspase activation inhibitor; AVEN; Cell death regulator Aven; mAven-L; mAven-S; PDCD12; programmed cell death 12
Common Name AVEN
Gene Symbol AVEN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.