missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208080

Invitrogen™ Human AXIN1 (aa 443-520) Control Fragment Recombinant Protein

Product Code. 30208080
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208080

Brand: Invitrogen™ RP109938

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145063 (PA5-145063. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AXIN1 is a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a disheveled and axin (DIX) domain and is thought to function as a negative regulator of the WNT signaling pathway that regulates embryonic axis formation. AXIN1 interacts with adenomatosis polyposis coli (APC), beta-catenin, glycogen synthase kinase 3 beta, forming a tetrameric complex resulting in the regulation of the stabilization of beta-catenin. Mutations in the AXIN1 gene have been associated various carcinomas, indicating that it also functions as a tumor suppressor.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15169
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8312
Name Human AXIN1 (aa 443-520) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI316800; AXIN; axin 1; Axin1; axin-1; Axis inhibition protein 1; axis inhibitor 1; Fu; fused; fused, mouse, homolog of; GSK-3 beta interacting protein rAxin; hAxin; Kb; Ki; kinky; knobbly; LA16c-314G4.3; MGC52315; PPP1R49; Protein Fused; protein phosphatase 1, regulatory subunit 49; rAxin
Common Name AXIN1
Gene Symbol AXIN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.