missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human beta Actin (aa 44-80) Control Fragment Recombinant Protein

Product Code. 30210886
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210886

Brand: Invitrogen™ RP104324

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Beta actin is one of six actin isoforms which have been identified. Beta actin is a non-muscle cytoskeletal protein in all human cell types and is involved in cell motility, structure, and integrity. There are six different actin isoforms in human. The beta isoform of actin, along with gamma actin, coexist in most cell types as components of the cyto-skeleton. Beta actins are cytoplasmic proteins ubuquitously expressed in all eukaryotic cells. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of two stranded helix. Actins are highly conserved proteins that are involved in cell motility, structure and integrity. Because beta actin is ubiquitously expressed in all eukaryotic cells, it is frequently used as a loading control for assays involving protein detection, such as Western blotting. Antibodies to beta-actin provide a specific and useful tool in studying the intracellular distribution of beta-actin and the static and dynamic aspects of the cytoskeleton.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P60709
Concentration 4.9 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60
Name Human beta Actin (aa 44-80) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1 b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1 b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1 b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631
Common Name beta Actin
Gene Symbol ACTB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.