missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201585

Invitrogen™ Human BMI-1 (aa 132-196) Control Fragment Recombinant Protein

Product Code. 30201585
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201585

Brand: Invitrogen™ RP105609

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number P35226
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 648
Name Human BMI-1 (aa 132-196) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW546694; B lymphoma Mo-MLV insertion region 1; B lymphoma Mo-MLV insertion region 1 homolog; Bmi1; Bmi-1; BMI1 polycomb ring finger oncogene; BMI1 polycomb ring finger proto-oncogene; BMI1 proto-oncogene, polycomb ring finger; FLVI2/BMI1; flvi-2/bmi-1; murine leukemia viral (bmi-1) oncogene homolog; Pcgf4; Pcgf4 antibody; Polycomb complex protein BMI-1; polycomb group protein Bmi1; polycomb group ring finger 4; polycomb group RING finger protein 4; RING finger protein 51; RNF51; RP11-573G6.1
Common Name BMI-1
Gene Symbol BMI1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt