missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205616

Invitrogen™ Human BRUNOL6 (aa 16-45) Control Fragment Recombinant Protein

Product Code. 30205616
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205616

Brand: Invitrogen™ RP100788

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62801 (PA5-62801. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. Promotes also exon exclusion of INSR pre-mRNA.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96J87
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60677
Name Human BRUNOL6 (aa 16-45) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330569O16Rik; Bruno -like 6, RNA binding protein; BRUNOL6; bruno-like 6, RNA binding protein; bruno-like protein 6; CELF6; CELF-6; CUG-BP and ETR-3 like factor 6; CUG-BP- and ETR-3-like factor 6; CUGBP Elav-like family member 6; CUGBP, Elav-like family member 6; RNA-binding protein BRUNOL-6
Common Name BRUNOL6
Gene Symbol CELF6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRLGFSTADSGVGMSGLNPGPAVPMKDHDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.