missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human c-Met Control Fragment Recombinant Protein

Product Code. 30198191
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30198191 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30198191 Supplier Invitrogen™ Supplier No. RP106648

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MET (cMET) is a receptor-like tyrosine kinase whose dysregulation has been linked to many types of human malignancies. After activation of the ligand, MET interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, and STAT3. There interactions lead to the activation of signaling cascades including RAS-ERK, PI3, kinase-AKT, and PLCgamma-PKC. MET plays a role in embryonic development including gastrulation, development of muscles and neurons, angiogenesis, and kidney formation. It also plays a role in adults including wound healing, organ regeneration, and tissue remodeling. MET has been linked to cancers including gastric, renal, and breast; therefore, making it a target for cancer therapeutics and diagnostic testing.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P08581
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4233
Name Human c-Met Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI838057; AUTS9; bHLHe59; CG1705; CG1705-PA; CG1705-PB; cmet; c-met; c-met proto-oncogene; c-Met receptor tyrosine kinase; c-Met/HGF receptor; D249; DFNB97; Dmel\CG1705; Dmel_CG1705; DmMet; EC 2.7.10.1; Hepatocyte growth factor receptor; HGF; HGF receptor; HGF receptor c-Met; HGF/SF receptor; HGFR; HGF-SF receptor; juvenile hormone resistance; met; met proto-oncogene; met proto-oncogene (hepatocyte growth factor receptor); met proto-oncogene tyrosine kinase; MET proto-oncogene, receptor tyrosine kinase; Met/Met1; Met; protein tyrosin kinase; methoprene tolerant; Methoprene-tolerant; Methoprene-tolerant protein; Met-PA; Met-PB; Mett; oncogene MET; Par4; Proto-oncogene c-Met; RCCP2; resistance (1) juvenile H; resistance to juvenile hormone; Rst(1)JH; sc MET; scatter factor receptor; SF receptor; soluble c met; tyrosine-protein kinase Met
Common Name c-Met
Gene Symbol MET
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.