missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182785

Invitrogen™ Human CACTIN (aa 550-629) Control Fragment Recombinant Protein

Product Code. 30182785
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182785

Brand: Invitrogen™ RP98977

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60019 (PA5-60019. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cactin is a novel negative regulator of TLR signaling and reveals its capacity to target MHC Class III genes at the molecular and functional level. It is localized to the nucleus, which is critical for manifesting its inhibitory effects on TLR signaling. Experimental evidences show overexpression of Cactin suppresses TLR-induced activation of NF-kB and interferon-regulatory factor transcription factors and induction of TLR-responsive genes. It is also reported Cactin interacts with IkB-like protein and targets other proteins that are encoded by genes in the MHC Class III region of chromosome 6.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WUQ7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 58509
Name Human CACTIN (aa 550-629) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2510012J08Rik; C19orf29; C20H19orf29; CACTIN; cactin, spliceosome C complex subunit; fSAPc; functional spliceosome-associated protein c; NY REN 24 antigen; NY-REN-24; NY-REN-24 antigen; renal carcinoma antigen NY-REN-24; RGD1563634
Common Name CACTIN
Gene Symbol CACTIN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.