missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181872

Invitrogen™ Human CALCOCO1 (aa 598-681) Control Fragment Recombinant Protein

Product Code. 30181872
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181872

Brand: Invitrogen™ RP97620

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58337 (PA5-58337. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CALCOCO1 (calcium-binding and coiled-coil domain-containing protein 1), also known as cocoa, calphoglin, sarcoma antigen NY-SAR-3 or coiled-coil coactivator protein, is a 691 amino acid protein that shuttles between the cytoplasm and nucleus and functions as coactivator for aryl hydrocarbon and nuclear receptors. A member of the CALCOCO family, CALCOCO1 is forms a calphoglin complex with PPA1 and PGM 1 and contains multiple functional domains through which it acts as a component of both the androgen signaling pathway and the Wnt/beta-catenin signaling pathway.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P1Z2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57658
Name Human CALCOCO1 (aa 598-681) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810009B06Rik; calcium binding and coiled coil domain 1; calcium binding and coiled-coil domain 1; calcium-binding and coiled-coil domain-containing protein 1; Calcoco1; Calphoglin; Cocoa; Coiled-coil coactivator protein; coiled-coil leucine zipper coactivator 1; coiled-coil transcriptional coactivator; Gcap11; granule cell antiserum positive 11; GRIP1-interacting protein; inorganic pyrophosphatase activator; KIAA1536; MGC128949 protein; mKIAA1536; PP13275; Sarcoma antigen NY-SAR-3; UNQ2436/PRO4996
Common Name CALCOCO1
Gene Symbol Calcoco1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAEDEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.