missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Calponin 1 (aa 198-296) Control Fragment Recombinant Protein

Product Code. 30205339
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205339

Brand: Invitrogen™ RP89632

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82499 (PA5-82499. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calponin, a thin filament associated protein is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. Calponin is expressed in smooth muscle and tissues containing significant amounts of smooth muscle. Two isoforms of calponin exist whose molecular weights are 34kDa and 29kDa. Expression of the 29kDa form is primarily restricted to muscle of the urogenital tract. The expression of calponin has also been demonstrated in myoepithelial cells from benign and malignant breast lesions. It stains smooth muscle, myoepithelial cells, myofibroblasts, keratinocytes and nerve fibers. It identifies myoepithelial cells in breast lesions, and helps differentiate breast collagenous spherulosis (positive) from adenoid cystic carcinoma. Adenoid cystic carcinoma in salivary gland tumors is calponin positive.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P51911
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1264
Name Human Calponin 1 (aa 198-296) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Basic calponin; calponin; calponin 1; calponin 1, basic, smooth muscle; calponin 1, smooth muscle; calponin H1, smooth muscle; Calponin-1; calponins, basic; CN; CNN1; CnnI; epididymis secretory protein Li 14; h1-calponin; HEL-S-14; similar to calponin 1, basic, smooth muscle; Sm-Calp; SMCC; smooth muscle calponin h1
Common Name Calponin 1
Gene Symbol CNN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.