missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198695

Invitrogen™ Human CaMKIV (aa 365-466) Control Fragment Recombinant Protein

Product Code. 30198695
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198695

Brand: Invitrogen™ RP89793

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CAMK4 (CaMKIV) is a serine/threonine protein kinase that phosphoryates CREB, oncoprotein 18, and SRF. It has limited tissue distribution, and has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells. The nuclear localization of this protein is consistent with its role in mediating calcium-dependent gene expression. CaMKIV is particularly abundant in testis, T-cells, and neurons but is also found in other tissues to varying degrees. In neurons, CaMKIV is thought to play an important role in synaptic plasticity via its gene regulatory effects. In T-cells, this protein plays an important role in calcium signaling which could affect the transcription regulatory protein, nuclear factor of activated T-cells (NFAT). CaMKIV is encoded, along with calspermin, by the CaMKIV gene. It has been found that, in testes, CaMKIV is expressed in germ cells and found to be associated with chromatin. The association of CaMKIV with chromatin suggests a potential role in chromatin remodeling during nuclear condensation in spermatids.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16566
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 814
Name Human CaMKIV (aa 365-466) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A430110E23Rik; AI666733; brain Ca(2+)-calmodulin-dependent protein kinase type IV; brain Ca++-calmodulin-dependent protein kinase type IV; Ca2+/calmodulin-dependent protein kinase type IV/Gr; Calcium/calmoduli; calcium/calmodulin dependent protein kinase IV; calcium/calmodulin-dependent protein kinase IV; calcium/calmodulin-dependent protein kinase IV L homeolog; calcium/calmodulin-dependent protein kinase type IV; calcium/calmodulin-dependent protein kinase type IV catalytic chain; Calmodulin-dependent protein kinase IV; calspermin; CAM kinase- GR; CAM kinase IV; CAM kinase-GR; CAMK; CaMK IV; camk4; camk4.L; camk4-A; CAMK-GR; CAMKIV; CaMKIV/Gr; Ccdpk; D18Bwg0362e; EC 2.7.11.17; KCC4; kinase CaMK4; OTTHUMP00000222818; RATCCDPK; xCaM; XELAEV_18008011mg
Common Name CaMKIV
Gene Symbol CAMK4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.