missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201277

Invitrogen™ Human Cannabinoid Receptor 1 (aa 298-344) Control Fragment Recombinant Protein

Product Code. 30201277
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201277

Brand: Invitrogen™ RP109197

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P21554
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1268
Name Human Cannabinoid Receptor 1 (aa 298-344) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias brain-type cannabinoid receptor; CANN6; Cannabinoid receptor 1; cannabinoid receptor 1 (brain); CB1; CB1 cannabinoid receptor; CB1 receptor; CB1A; CB1K5; CB1R; CB-R; central cannabinoid receptor; CNR; Cnr1; HGNC:2159; OTTHUMP00000016839; RP1-23D17.1; seven transmembrane domains; G-protein-coupled receptor; Skr6; SKR6R; striatal cannabinoid receptor type 1 protein
Common Name Cannabinoid Receptor 1
Gene Symbol CNR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.