missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Carbonic Anhydrase III (aa 190-260) Control Fragment Recombinant Protein

Product Code. 30202932
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202932 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202932 Supplier Invitrogen™ Supplier No. RP92483

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82931 (PA5-82931. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10. 3 kb and contains seven exons and six introns.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P07451
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 761
Name Human Carbonic Anhydrase III (aa 190-260) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BB219044; CA III; Ca3; CAH3; CAIII; CA-III; CAIII (Muscle); Car3; Car-3; Carbonate dehydratase III; carbonic anhydrase 3; Carbonic anhydrase III; carbonic anhydrase III, muscle specific; carbonic anhydrase-like protein; EC 4.2.1.1; epididymis secretory sperm binding protein Li 167 mP; HEL-S-167 mP
Common Name Carbonic Anhydrase III
Gene Symbol Ca3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.