missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202308

Invitrogen™ Human Carboxypeptidase A1 (aa 19-88) Control Fragment Recombinant Protein

Product Code. 30202308
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202308

Brand: Invitrogen™ RP92630

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84105 (PA5-84105. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CPA1, also known as CPA, is a 419 amino acid secreted monomeric protein that is highly expressed in pancreatic tissue. Functioning as a pancreatic exopeptidase, CPA1 uses zinc as a cofactor to catalyze the release of C-terminal amino acids from a variety of proteins, thereby playing a key role in protein digestion and degradation. Via its catalytic activity, CPA1 is also thought to be involved in zymogen (proenzyme) inhibition, probably functioning to block enzyme activation pathways. Abnormal levels of CPA1 are associated with pancreatic cancer, suggesting a possible role in either tumor progression or tumor suppression events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P15085
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1357
Name Human Carboxypeptidase A1 (aa 19-88) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0910001L12Rik; carboxypeptidase A; carboxypeptidase A1; carboxypeptidase A1 (pancreatic); carboxypeptidase A1, pancreatic; CPA; Cpa1; pancreatic carboxypeptidase A; pancreatic procarboxypeptidase A
Common Name Carboxypeptidase A1
Gene Symbol Cpa1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.