missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211522

Invitrogen™ Human Caspase 3 (aa 22-136) Control Fragment Recombinant Protein

Product Code. 30211522
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211522

Brand: Invitrogen™ RP102173

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P42574
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 836
Name Human Caspase 3 (aa 22-136) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A830040C14Rik; AC-3; Apopain; Apopain precursor; Casp3; CASP-3; caspase 3; Caspase 3 apoptosis related cysteine protease (ICE-like cysteine protease); caspase 3, apoptosis related cysteine protease; Caspase 3, apoptosis related cysteine protease (ICE-like cysteine protease); caspase 3, apoptosis-related cysteine peptidase; caspase 3, apoptosis-related cysteine protease; Caspase3; caspase-3; Caspase-3 subunit p12; Caspase-3 subunit p17; Caspase-3-like protein; CC3; Cpp32; CPP-32; CPP32B; CPP32beta; cysteine protease CPP32; cysteine protease; CPP32; apopain; ICE3; IRP; LICE; mldy; PARP cleavage protease; procaspase3; protein Yama; SCA-1; SREBP cleavage activity 1; Yama; yama protein
Common Name Caspase 3
Gene Symbol CASP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.