missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204666

Invitrogen™ Human CD147 (aa 148-289) Control Fragment Recombinant Protein

Product Code. 30204666
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204666 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204666 Supplier Invitrogen™ Supplier No. RP96772

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD147 (basigin, neurothelin, OX-47, 5A11, CE9, M6, EMMPRIN, extracellular matrix metalloproteinase inducer, TCSF, tumour cell-derived collagenase-stimulatory factor) is a 50-60 kDa glycoprotein with multiple glycosylated forms. CD147 is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. CD147 is also a member of the immunoglobulin superfamily. The highest level of CD147 expression is on metabolically active cells, such as lymphoblasts, inflammatory cells, brown adipocytes and malignant tumor cells. CD147 has multiple functions, including facilitating of cell surface expression of monocarboxylate transporter proteins and extracellular matrix metalloproteinases, regulation of integrin functions, it plays roles in cell development and activation, fetal development or retinal function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35613
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 682
Name Human CD147 (aa 148-289) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5A11; 5A11 antigen; 5A11/Basigin; 5A11/Basigin-2; 5F7; AI115436; AI325119; Basic immunoglobulin superfamily; basigin; basigin (Ok blood group); Basigin (O x 47 antigen or CE-9) (EMMPRIN in human) (neurothelin HT7 or 5A11 in avian); basignin; Basignin (O x 47 antigen or CE-9) (EMMPRIN in human) (neurothelin HT7 or 5A11 in avian); blood-brain barrier HT7 antigen; BSG; CD147; CD147 antigen; CE9; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; glycoprotein CE9; gp 42; gp42/basigin/OX-47/HT7; HT7; HT-7; HT7 antigen; immunoglobulin gene superfamily member; leukocyte activation antigen M6; Membrane glycoprotein gp42; neurothelin; OK; OK blood group antigen; OX-47 antigen; O x 47 R; RPE7; TCSF; tumor cell-derived collagenase stimulatory factor; Unknown (protein for MGC:128392); unnamed protein product; UNQ6505/PRO21383
Common Name CD147
Gene Symbol BSG
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.