missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208988

Invitrogen™ Human CD5 Control Fragment Recombinant Protein

Product Code. 30208988
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208988

Brand: Invitrogen™ RP102942

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83657 (PA5-83657. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD5 is a 67 kDa human T-lymphocyte single-chain transmembrane glycoprotein. CD5 is present on all mature T-lymphocytes, on most of thymocytes and on many T-cell leukemias and lymphomas. CD5 also reacts with a subpopulation of activated B-cells and may act as a receptor in regulating T-cell proliferation. CD5 is found on 95% of thymocytes and 72% of peripheral blood lymphocytes. In lymph nodes, the main reactivity is observed in T cell areas. CD5 is expressed by many T cell leukemia, lymphomas, and activated T cells. Diseases associated with CD5 dysfunction include thymus cancer and Richter's Syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P06127
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 921
Name Human CD5 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alanyl (membrane) aminopeptidase; alanyl aminopeptidase; alanyl aminopeptidase, membrane; aminopeptidase M; Aminopeptidase N; ANPEP; AP-M; APN; AP-N; CD antigen CD5; CD13; CD28; CD28 antigen (Tp44); CD28 molecule; Cd5; CD5 antigen; CD5 antigen (p56 62); CD5 antigen (p56-62); CD5 antigen p56-62; CD5 molecule; CD5 protein; CD74 antigen, invariant polypeptide of major; cell surface protein; costimulatory molecule B7 receptor CD28; fCD5; GP150; hAPN; LAP1; LEU1; Ly-1; Ly12; Ly-12; LyA; Ly-A; Lymphocyte antigen 1; Lymphocyte antigen CD5; lymphocyte antigen T1/Leu-1; Lyt-1; membrane alanyl aminopeptidase; microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; P150; Pan T cell; PEPN; T1; T-cell costimulatory molecule CD28; T-cell surface glycoprotein CD5; T-cell-specific surface glycoprotein CD28; unnamed protein product
Common Name CD5
Gene Symbol Cd5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDLGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.