missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208797

Invitrogen™ Human CD79a (aa 32-84) Control Fragment Recombinant Protein

Product Code. 30208797
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208797 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208797 Supplier Invitrogen™ Supplier No. RP109786

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD79a is a disulphide-linked heterodimer that includes B29 (CD79b) polypeptide. CD79a is a B lymphocyte antigen receptor with an antigen-specific surface component Ig (immunoglobulin) that associates with Ig-alpha and Ig-beta, necessary elements for the expression and function of the B-cell antigen receptor. CD79a first appears at pre-B cell stage and persists until the plasma cell stage where it is found as an intracellular component. CD79a is found in the majority of acute leukemias of precursor B cell type, in B cell lines, B cell lymphomas, and in some myelomas. It is not present in myeloid or T cell lines. Diseases associated with CD79a include Agammaglobulinemia 3 and Agammaglobulinemia, Non-Bruton type.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P11912
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 973
Name Human CD79a (aa 32-84) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B-cell antigen receptor; B-cell antigen receptor complex-associated protein alpha chain; B-cell antigen receptor complex-associated protein alpha chain-like; CD79; CD79a; CD79A antigen (immunoglobulin-associated alpha); CD79a molecule; CD79a molecule, immunoglobulin-associated alpha; CD79A protein; CD79-alpha protein; EGK_10665; Ig alpha; IGA; Igalpha; ig-alpha; immunoglobulin-associated alpha; LOC100913063; Ly54; Ly-54; MB1; MB-1; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; surface IgM-associated protein
Common Name CD79a
Gene Symbol CD79A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.