missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD81 (aa 114-204) Control Fragment Recombinant Protein

Product Code. 30198877
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198877

Brand: Invitrogen™ RP88747

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82288 (PA5-82288. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD81 (TAPA-1, target of anti-proliferative antibody-1) is a member of the tetraspanin family, is expressed on virtually all nucleated cells, but above all on germinal center B cells. CD81 forms complexes with other tetraspanin proteins, integrins, coreceptors, MHC class I and II molecules, and influences adhesion, morphology, activation, proliferation and differentiation of B, T cells. In muscles, CD81 promotes cell fusion and myotube maintenance. CD81 has been also identified as a receptor for the hepatitis C virus. Like members of the tetraspanin family that include CD9, CD37, CD53, CD63, and CD82, CD81 is a cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. CD81 is a cell surface glycoprotein that is known to complex with integrins. CD81 appears to promote muscle cell fusion and support myotube maintenance. CD81 associates with CD19, CD21, Leu 13, and integrins on cell membrane and acts as a receptor for the envelope protein E2 of chronic hepatitis C virus. Antibodies to CD81 have anti-proliferative effects on different lymphoid cell lines, particularly those derived from large cell lymphomas. CD81 is also localized in the tumor-suppressor gene region and is a candidate gene for malignancies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P60033
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 975
Name Human CD81 (aa 114-204) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 26 kDa cell surface protein TAPA-1; CD 81 antigen; Cd81; CD81 antigen; CD81 antigen (target of antiproliferative antibody 1); CD81 molecule; CVID6; S5.7; Tapa1; Tapa-1; Target of the antiproliferative antibody 1; Tetraspanin28; tetraspanin-28; Tspan28; Tspan-28
Common Name CD81
Gene Symbol CD81
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.