missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205122

Invitrogen™ Human CD96 (aa 361-440) Control Fragment Recombinant Protein

Product Code. 30205122
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205122

Brand: Invitrogen™ RP103944

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD96 is a cell adhesion receptor also known as TACTILE. A member of the Ig superfamily, CD96 is a single pass transmembrane protein consisting of three extracellular Ig-like domains and a proline/serine/threonine rich region. CD96 is expressed on resident monocytes and T cells at all developmental stages (including gamma-delta T cells, thymocytes, and NK cells). In the mouse, this receptor is not expressed on B cells. Unlike in humans, mouse CD96 does not exist as alternative splice variants. Reports indicate that CD96 binds CD155/poliovirus receptor and Nectin-1 to mediate NK cell adhesion to target cells and cytotoxicity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P40200
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10225
Name Human CD96 (aa 361-440) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700109I12Rik; Cd96; CD96 antigen; CD96 molecule; cell surface antigen CD96; DKFZp667E2122; sCD96; soluble CD96; T cell activation, increased late expression; t cell-activated increased late expression protein; Tactile; T-cell surface protein tactile
Common Name CD96
Gene Symbol Cd96
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.