missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193917

Invitrogen™ Human CDK5RAP3 (aa 408-506) Control Fragment Recombinant Protein

Product Code. 30193917
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193917

Brand: Invitrogen™ RP93195

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54569 (PA5-54569. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, May 2013].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96JB5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80279
Name Human CDK5RAP3 (aa 408-506) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810007E24Rik; BC002318; C53; C81486; CDK5 activator-binding protein C53; CDK5 activator-binding protein C53; CDK5 regulatory subunit associated protein 3; CDK5 regulatory subunit associated protein IC53-2; CDK5 regulatory subunit-associated protein 3; Cdk5rap3; HSF-27; IC53; IC53-2; ischemic heart CDK5 activator-binding protein C53; LXXLL/leucine-zipper-containing ARFbinding protein; LXXLL/leucine-zipper-containing ARF-binding protein; LZAP; MST016; MSTP016; OK/SW-cl0.114; PP1553; Protein HSF-27
Common Name CDK5RAP3
Gene Symbol CDK5RAP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.