missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202222

Invitrogen™ Human CDK6 (aa 219-324) Control Fragment Recombinant Protein

Product Code. 30202222
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202222

Brand: Invitrogen™ RP102056

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK6 functions as a cell-cycle initiator protein. This protein is coexpressed and copurified with CyclinD1. They are critical regulators of cell cycle progression. The prototype member of this family, p34cdc2, and a related protein cdk2, function late in the cycle while cdk4 and cdk6 are critically involved in G1 to S progression. CDK6 is essential for cell proliferation within the dentate gyrus of the hippocampus and the cuventricular zone of the lateral ventricles. Mutations in the gene results in microcephaly 12, primary, autosomal recessive (MCPH12).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q00534
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1021
Name Human CDK6 (aa 219-324) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5830411I20; AI504062; CDK6; CDKN6; Cell division protein kinase 6; CR2 protein kinase; Crk2; cyclin dependent kinase 6; cyclin-dependent kinase 6; MCPH12; MGC59692; PLSTIRE; Serine/threonine-protein kinase PLSTIRE
Common Name CDK6
Gene Symbol CDK6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.