missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182341

Invitrogen™ Human CHD9 (aa 1999-2117) Control Fragment Recombinant Protein

Product Code. 30182341
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182341

Brand: Invitrogen™ RP98769

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61963 (PA5-61963. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHD9 (chromodomain-helicase-DNA-binding protein 9), also known as chromatin-related mesenchymal modulator (CReMM), PPAR-α-interacting complex protein, kismet homolog 2 or CHROM1, is a 2,897 amino acid protein belonging to the Snf2/Rad54 helicase family. The CHD family of proteins are ATP-dependent chromatin remodeling enzymes which combine chromodomains with SWI2/Snf2 ATPase/helicase motifs and DNA-binding capability. Localized to the cytoplasm and the nucleus, CHD9 contains two chromodomains, one ATPbinding helicase domain and one C-terminal helicase domain. Chromodomains are protein regions of about 40-50 amino acid residues found in proteins associated with chromatin remodeling and manipulation. The domain is highly conserved among both plants and animals and is found in a large variety of proteins from many genomes. CHD9 acts as a transcriptional coactivator for PPARα and may also be an ATP-dependent chromatin remodeling protein. CHD9 is widely expressed at low levels and is present as three isoforms produced by alternative splicing.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q3L8U1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80205
Name Human CHD9 (aa 1999-2117) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810014J18Rik; 9030205D12Rik; A330063D19Rik; AD013; AD-013; ATP-dependent helicase CHD9; BC022889; Chd9; CHD-9; chromatin remodeling factor CHROM1; chromatin-related mesenchymal modulator; Chromatin-remodeling factor CHROM1; chromodomain helicase DNA binding protein 9; chromodomain-helicase-DNA-binding protein 9; ciprofibrate bound protein p240; ciprofibrate-bound protein PRIC320; CReMM; FLJ12178; Kiaa0308; KISH2; Kismet homolog 2; mKIAA0308; peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein; PPAR{gamma}-interacting cofactor 320 kDa; PPAR-alpha-interacting complex protein 320 kDa; PRIC320; protein x 0008; x0008
Common Name CHD9
Gene Symbol Chd9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RNYSQSKMAHSRTSTPLLQQYQVALSASPLTSLPRLLDAKGIILEEMKVKSENLKEEPQSSEEESMSSVETRTLIKSEPVSPKNGVLPQATGDQKSGGKCETDRRMVAARTEPLTPNPA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.