missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200615

Invitrogen™ Human CHKB (aa 282-357) Control Fragment Recombinant Protein

Product Code. 30200615
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200615

Brand: Invitrogen™ RP92367

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53847 (PA5-53847. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. Choline kinase, the initial enzyme in the sequence, plays a role in cell growth proliferation. A related protein, ChoKB (also, known as choline kinase beta), is a 395 amino acid enzyme that catalyzes the phosphorylation of choline by ATP in the presence of magnesium, thereby yielding phosphocholine and ADP. Like all choline kinases, ChoKB possesses ethanoalamine kinase activity and catalyzes the phosphorylation of ethanolamine. The gene encoding ChoKB is located less than 1 kb upstream of the CPT1B gene, suggesting that the ChoKB gene may regulate transcription CPT1B. In mice, mutations and/or deletions in the gene encoding ChoKB are the cause of hindlimb muscular dystrophy and neonatal bone deformity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y259
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1120
Name Human CHKB (aa 282-357) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Chetk; CHKB; Chkl; choline kinase beta; Choline kinase-like protein; choline/ethanolamine kinase; choline/ethanolamine kinase beta; choline/ethanolamine kinase-b; choline/ethanolaminekinase; CK; Ck/Ek; Ck/Ek-beta; CKB; CKEKB; EK; EKB; ethanolamine kinase; Ethanolamine kinase beta; MDCMC
Common Name CHKB
Gene Symbol CHKB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.