missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30180965

Invitrogen™ Human CNO (aa 68-134) Control Fragment Recombinant Protein

Product Code. 30180965
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Product Code. Quantity unitSize
30180965 100 μL 100µL
1 missing translation for 'options'
This item is not returnable. View return policy

Product Code. 30180965

Brand: Invitrogen™ RP99983

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60534 (PA5-60534. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NUP1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55330
Name Human CNO (aa 68-134) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610101N07Rik; BCAS4L; biogenesis of lysosomal organelles complex 1 subunit 4; biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino; biogenesis of lysosome-related organelles complex 1 subunit 4; biogenesis of organelles complex-1, subunit 4, cappuccino; BLOC-1 subunit 4; BLOC1S4; Blos4; cappuccino; cappuccino homolog; CNO; Protein cappuccino homolog; RGD1306037
Common Name CNO
Gene Symbol BLOC1S4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.