missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197690

Invitrogen™ Human Connexin 46 (aa 102-143) Control Fragment Recombinant Protein

Product Code. 30197690
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197690

Brand: Invitrogen™ RP105732

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64957 (PA5-64957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Connexin 46 (Cx46), also known as Gap Junction Protein Alpha-3 (GJA3), CAE3, CX46 and C2P3, maps to human chromosome 13q11-q12 and encodes a 46 kDa protein. Cx46, along with Cx50, is principally expressed in the lens of the eye. Cx46 mediates intercellular interactions during development and is necessary for the survival of neural crest cells. Cx46 forms gap junctions that connect lens fiber cells and are crucial for maintaining lens transparency and normal lens function. Mutations of Cx46 result in severe cataracts of the lens. Individual knockouts of Cx46 and Cx50 lead to changes in the rate of lens fiber cell differentiation and cell size, thus the interaction of Cx46 and Cx50 is required for proper organization of fiber cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6H8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2700
Name Human Connexin 46 (aa 102-143) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha 3 connexin; Cn x 46; connexin 46; connexin-46; CTRCT14; C x 43; C x 46; Cxn-46; CZP3; gap junction alpha 3; gap junction alpha-3 protein; gap junction membrane channel protein alpha 3; gap junction protein alpha 3; gap junction protein, alpha 3; gap junction protein, alpha 3, 46 kDa; Gja3; Gja-3
Common Name Connexin 46
Gene Symbol GJA3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.