missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human COX5B (aa 32-124) Control Fragment Recombinant Protein

Product Code. 30209397
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209397

Brand: Invitrogen™ RP95792

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56963 (PA5-56963. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The cytochrome c oxidase (COX) family of proteins function as the final electron donor in the respiratory chain to drive a proton gradient across the inner mitochondrial membrane, ultimately resulting in the production of water. The mammalian COX apoenzyme is a dimer, with each monomer consisting of 13 subunits, some of which are mitochondrial and some of which are nuclear. Found in the inner mitochondrial membrane, COX5 is the heme A-containing chain of the oxidase family that converts one molecule of oxygen and four molecules of hydrogen to two molecules of water. Two isoforms of COX5 exist, COX5a and COX5b. When oxygen levels within the cell are high, transcription of COX5a (the aerobic isoform) is up-regulated as the rate of cellular respiration increases. Conversely, when oxygen levels are low, COX5b (the hypoxic isoform) transcription increases and functions to maximize the turnover rate of the COX apoenzyme.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10606
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1329
Name Human COX5B (aa 32-124) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CO x 5 B; COXVB; cytochrome c oxidase polypeptide Vb; cytochrome c oxidase polypeptide VB, mitochondrial; cytochrome c oxidase polypeptide VIa; cytochrome c oxidase precursor (EC 1.9.3.1); cytochrome c oxidase subunit 5 B; cytochrome c oxidase subunit 5 B, mitochondrial; cytochrome c oxidase subunit Vb; cytochrome c oxidase subunit VIA*
Common Name COX5B
Gene Symbol COX5B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.