missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CRHBP (aa 171-245) Control Fragment Recombinant Protein

Code produit. 30209894
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30209894

missing translation for 'mfr': Invitrogen™ RP96883

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-140061 (PA5-140061, PA5-61157 (PA5-61157. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Response to stress in mammals requires an intact hypothalamic-pituitary-adrenal axis. The proximal part of the response is mediated by secretion of corticotropin-releasing hormone (CRH) by the paraventricular nucleus of the hypothalamus. CRH is a 41 amino acid peptide derived by enzymatic cleavage from a 191 amino acid preprohormone. CRH is produced not only in the hypothalamus but also in peripheral tissues, such as T lymphocytes; it is highly expressed in human placenta. Glucocorticoids stimulate placental CRH synthesis and secretion in primary cultures of human placenta. This stimulation is in contrast to the glucocorticoid suppression of CRH expression in hypothalamus. The gene which encodes CRH maps to human chromosome 8q13. Human plasma contains a CRH-binding protein, CRH-BP (also designated CRF-BP) which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. The gene which encodes CRF-BP maps to human chromosome 5q11.2-q13.3.
TRUSTED_SUSTAINABILITY

Spécification

Accession Number P24387
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1393
Name Human CRHBP (aa 171-245) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias corticotropin releasing factor binding protein; corticotropin releasing hormone binding protein; corticotropin releasing hormone-binding protein; corticotropin-releasing factor-binding protein; Corticotropin-releasing hormone-binding protein; CRF-binding protein; CRFBP; CRF-BP; Crhbp; CRH-BP
Common Name CRHBP
Gene Symbol CRHBP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis