missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CTCF (aa 42-189) Control Fragment Recombinant Protein

Product Code. 30206474
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206474

Brand: Invitrogen™ RP96686

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional factor CTCF is a ubiquitously expressed 11-zinc finger domain containing, DNA-binding nuclear phosphoprotein that is involved in multiple aspects of normal gene regulation including transcriptional repression and activation, gene silencing, chromatin insulation and regulation of imprinted sites. CTCF uses different combinations of ZF domains and interacts with the CCCTC motif on the DNA. It can bind to HAT- and HDAC-containing complexes thereby influencing transcriptional activation or repression respectively. It is a multifunctional protein involved in the transactivation of APPB gene, silencing of c-myc gene, and insulation of human beta-globin and DMI myotonic dystrophy locus and imprinting control of IGF2 and H19 regions. CTCF has also been shown to regulate the transcription of Pax6 and IRAK2 promoter thereby opening a therapeutic avenue. Mutations in this gene have been associated with invasive breast cancers, prostate cancers and Wilms' tumors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49711
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10664
Name Human CTCF (aa 42-189) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 11 zinc finger transcriptional repressor; 11-zinc finger protein; AW108038; CCCTC-binding factor; CCCTC-binding factor (zinc finger protein); Ctcf; ctcf protein; CTCFL paralog; im:7152666; MRD21; OTTHUMP00000197610; Transcriptional repressor CTCF; Unknown (protein for IMAGE:8125283)
Common Name CTCF
Gene Symbol CTCF
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.