missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195088

Invitrogen™ Human CTNNA3 (aa 151-223) Control Fragment Recombinant Protein

Product Code. 30195088
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195088

Brand: Invitrogen™ RP103793

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63987 (PA5-63987. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catenins are proteins that connect cadherin/beta-catenin cell adhesion complexes to the actin cytoskeleton. Although originally discovered in testis, alphaT-catenin is expressed in other tissues, the highest levels being observed in heart. Immunohistochemical analysis showed human alphaTcatenin localization at intercalated discs of cardiomyocytes and in peritubular myoid cells of testis. It is proven that alphaT-catenin can functionally restore cell-cell adhesion in colon cancer cells lacking alpha-catenins. This indicates that this protein is involved in the formation of specific cell-cell contacts in specific types of muscle cells. The encoded protein has about the same predicted size (100 kDa) as other alpha-catenins to which it shows an overall amino acid identity of 57%. In cells transfected with alphaT-catenin cDNA, interaction with alpha-catenin was demonstrated by coimmunoprecipitation. The 892_24D2S antibody against alphaT-catenin does not show any cross reaction with alphaE-catenin or alphaNcatenin in western blot analysis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UI47
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29119
Name Human CTNNA3 (aa 151-223) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930429L08Rik; 4933408A16; Alpha T-catenin; Alpha-3 catenin; alpha-catenin-like protein; alpha-T-catenin; ARVD13; Cadherin-associated protein; catenin (cadherin associated protein), alpha 3; catenin (cadherin-associated protein), alpha 3; catenin alpha 3; catenin alpha-3; Catna3; CTNNA3; RGD1559455; RGD1562230; Vr22
Common Name CTNNA3
Gene Symbol CTNNA3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.