missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CTNNBL1 (aa 476-561) Control Fragment Recombinant Protein

Product Code. 30211139
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211139

Brand: Invitrogen™ RP108776

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a component of the pre-mRNA-processing factor 19-cell division cycle 5-like (PRP19-CDC5L) protein complex, which activates pre-mRNA splicing and is an integral part of the spliceosome. The encoded protein is also a nuclear localization sequence binding protein, and binds to activation-induced deaminase and is important for antibody diversification. This gene may also be associated with the development of obesity. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been defined on the X chromosome. Diseases associated with CTNNBL1 include Immunodeficiency 99 With Hypogammaglobulinemia And Autoimmune Cytopenias.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WYA6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56259
Name Human CTNNBL1 (aa 476-561) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730471K09Rik; beta catenin-like 1; beta-catenin-like protein 1; C20orf33; catenin beta like 1; catenin, beta like 1; CTNNBL1; dJ633O20.1; NAP; nuclear associated protein; nuclear protein NAP; nuclear-associated protein; NYD-SP19; P14L; PP8304; RP5-1118M15.1; Testis development protein NYD-SP19
Common Name CTNNBL1
Gene Symbol CTNNBL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.