missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201453

Invitrogen™ Human Cullin 9 (aa 2269-2376) Control Fragment Recombinant Protein

Product Code. 30201453
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201453

Brand: Invitrogen™ RP106368

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65694 (PA5-65694. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The continued localization of p53 to the nucleus is essential for its function as a tumor suppressor. PARC, a large, Parkin-like ubiquitin ligase has recently been identified as a cytoplasmic anchor protein in p53-associated protein complexes. In the absence of stress, PARC inactivation results in nuclear localization of p53 and activation of p53-dependent apoptosis, while overexpression of this protein promoted cytoplasmic sequestration of p53. Surprisingly, PARC knockout mice were viable and exhibited no obvious phenotype, suggesting that other proteins, such as the highly related cullin family of E3 ubiquitin ligases, may perform similar functions in the absence of PARC. Additionally, it has been suggested that p53 binding to PARC may serve to control PARC function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IWT3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23113
Name Human Cullin 9 (aa 2269-2376) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810035I07Rik; CUL9; CUL-9; cullin 9; cullin-9; H7AP1; KIAA0708; mKIAA0708; p53-associated parkin-like cytoplasmic protein; PARC; parkin-like cytoplasmic p53 binding protein; RP3-330M21.2; UbcH7-associated protein 1
Common Name Cullin 9
Gene Symbol CUL9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WKPNHKDYYNCSAMVSKAARQEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLEQARKVLAYACVYSFYSQDAEYMDVVEQQTENLELHT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.