missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195371

Invitrogen™ Human CXXC4 Control Fragment Recombinant Protein

Product Code. 30195371
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195371

Brand: Invitrogen™ RP96727

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57737 (PA5-57737. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CXXC4 is zinc finger protein that binds directly to the PDZ domain of DVL1, a protein involved in the Wnt signaling pathway, through its C-terminal region. CXXC4 interaction with DVL1 competes with DVL1-AXIN binding, although the affinity of DVL1 for CXXC4 is lower than that for AXIN. In mouse fibroblasts, CXXC4 suppressed Wnt3a induction of beta-catenin and inhibited Wnt3a-dependent TCF4 activation, suggesting that CXXC4 acts as a negative regulator of the Wnt signaling pathway and functions between DVL and beta-catenin. Recent reports suggest that decreased CXXC4 expression is associated with kidney cancer metastasis, cell proliferation, reduced apoptosis in response to cancer drugs, and upregulation of genes involved with proliferation, invasion and cell survival, suggesting that CXXC4 plays a critical role in tumor progression in kidney cancer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H2H0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80319
Name Human CXXC4 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9330210J02Rik; C030003J12Rik; CXXC finger 4; CXXC finger protein 4; CXXC4; CXXC-type zinc finger protein 4; Dvl-binding protein IDAX (inhibition of the Dvl and Axin complex); Idax; inhibition of the Dvl and axin complex protein; inhibitor of the Dvl and Axin complex
Common Name CXXC4
Gene Symbol CXXC4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSRTSMHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.