missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205466

Invitrogen™ Human Cyclin B1 (aa 6-77) Control Fragment Recombinant Protein

Product Code. 30205466
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205466

Brand: Invitrogen™ RP105188

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84499 (PA5-84499. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclins bind to and regulate the activity of the Cyclin dependent protein kinases (CDKs). Cyclin B1 or CCNB1 is a regulatory protein involved in mitosis. It is essential for the control of the cell cycle at the G2/M transition. Cyclin B1 complexes with p34 (cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. Cyclin B1 is not ubiquitinated during G2/M phase, resulting in its steady accumulation during G2 phase, followed by abrupt APC dependent destruction at the end of mitosis. Destruction of Cyclin B1 is required for cell cycle progression. Cyclin B1 is overexpressed in various cancers, including breast, prostate, and non-small cell lung cancer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P14635
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 891
Name Human Cyclin B1 (aa 6-77) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Ccn-2; CCNB; Ccnb1; Ccnb1-rs1; Ccnb1-rs13; Cycb; Cycb1; Cycb1-rs1; Cycb-4; Cycb-5; cyclin B; cyclin B1; cyclin B1, related sequence 1; cyclin B1, related sequence 13; G2/mitotic-specific cyclin B1; G2/mitotic-specific cyclin-B1; I79_013589; OTTHUMP00000221981; OTTHUMP00000223023
Common Name Cyclin B1
Gene Symbol Ccnb1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.