missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198143

Invitrogen™ Human CYFIP1 (aa 160-218) Control Fragment Recombinant Protein

Product Code. 30198143
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30198143 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30198143 Supplier Invitrogen™ Supplier No. RP103976

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64360 (PA5-64360. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. Promotes the translation repression activity of FMR1 in brain probably by mediating its association with EIF4E and mRNA. Involved in formation of membrane ruffles and lamellipodia protrusions and in axon outgrowth. Binds to F-actin but not to RNA. Regulator of epithelial morphogenesis. May act as an invasion suppressor in cancers.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7L576
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23191
Name Human CYFIP1 (aa 160-218) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CY; CYFIP; cyfip1; cyfip1 protein; cytoplasmic FMR1 interacting protein 1; cytoplasmic FMR1-interacting protein 1; Cytoplasmic FMR1-interacting protein 1 homolog; cytoplasmic FMRP interacting protein 1; E030028J09Rik; fb15a06; FLJ45151; FMR1-interacting protein 1; KIAA0068; l(7)1 Rl; l71Rl; l7Rl1; LOW QUALITY PROTEIN: cytoplasmic FMR1-interacting protein 1; mKIAA0068; P140sra1; p140sra-1; pl-1; selective hybridizing clone; Shyc; Specifically Rac1-associated protein 1; Sra1; Sra-1; Unknown (protein for IMAGE:7152255); wu:fb15a06
Common Name CYFIP1
Gene Symbol Cyfip1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.