missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CYP21A2 Control Fragment Recombinant Protein

Product Code. 30202228
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202228

Brand: Invitrogen™ RP100043

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83939 (PA5-83939. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CYP21A2 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in CYP21A2 gene cause congenital adrenal hyperplasia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P08686
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1589
Name Human CYP21A2 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 21-OHase; CA21H; CAH1; CPS1; CYP21; CYP21A2; CYP21B; Cytochrome P450 21; cytochrome P450 family 21 subfamily A member 2; cytochrome P450 XXI; cytochrome P450, family 21, subfamily A, polypeptide 2; cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenal hyperplasia), polypeptide 2; Cytochrome P-450c21; Cytochrome P450-C21; Cytochrome P450-C21B; P-450c21; P450-C21; P450c21B; P450-C21B; steroid 21 hydroxylase; steroid 21-hydroxylase; steroid 21-monooxygenase
Common Name CYP21A2
Gene Symbol CYP21A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.