missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209170

Invitrogen™ Human Cytohesin 2 (aa 37-72) Control Fragment Recombinant Protein

Product Code. 30209170
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209170

Brand: Invitrogen™ RP108448

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84464 (PA5-84464. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99418
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9266
Name Human Cytohesin 2 (aa 37-72) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ARF exchange factor; ARF nucleotide binding site opener; ARF nucleotide-binding site opener; ARNO; CLM2; CTC-273B12.8; CTS18; CTS18.1; Cyth2; cytohesin 2; cytohesin-2; mSec7-2; PH, SEC7 and coiled-coil domain-containing protein 2; pleckstrin homology, Sec7 and coiled/coil domains 2 (cytohesin-2); pleckstrin homology, Sec7 and coiled-coil domains 2; pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2); Protein ARNO; PSCD2; PSCD2L; Sec7; SEC7 homolog B; Sec7b; SEC7L; Sec7p-L; Sec7p-like
Common Name Cytohesin 2
Gene Symbol CYTH2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.