missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208245

Invitrogen™ Human DDX5 (aa 530-608) Control Fragment Recombinant Protein

Product Code. 30208245
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208245 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208245 Supplier Invitrogen™ Supplier No. RP109250

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. This gene consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P17844
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1655
Name Human DDX5 (aa 530-608) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2600009A06Rik; ATP-dependent RNA helicase DD x 5; DD x 5; dd x 5 gene protein; D-E-A-D (aspartate-glutamate-alanine-aspartate) box polypeptide 5; DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 5; DEAD (Asp-Glu-Ala-Asp) box helicase 5; DEAD (Asp-Glu-Ala-Asp) box polypeptide 5; DEAD box protein 5; DEAD box RNA helicase DEAD1; DEAD box-5; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68 kD); DEAD-box helicase 5; DKFZp434E109; DKFZp686J01190; G17P1; HELR; Hlr1; HUMP68; mDEAD1; MGC118083; p68; p68 RNA helicase; PCR product with interspecies-compatible primers; probable ATP-dependent RNA helicase DD x 5; RNA helicase p68; RP23-247J12.4
Common Name DDX5
Gene Symbol DDX5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.