missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16067696

Abnova™ Human DIABLO (NP_063940.1) Full-length Recombinant Protein expressed in yeast

Product Code. 16067696
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16067696 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16067696 Supplier Abnova™ Supplier No. P3733.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for SDS-PAGE

This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and it moderates the caspase inhibition of IAPs. Multiple polyadenylation sites have been found for this gene. Four alternatively spliced transcript variants have been described for this gene, with two of them encoding different isoforms and the other two probably not encoding a protein. [provided by RefSeq]

Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Specifications

Accession Number NP_063940.1
For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 56616
Molecular Weight (g/mol) 27.1kDa
Name DIABLO (Human) Recombinant Protein
Preparation Method Yeast expression system
Purification Method Affinity Purification
Quantity 100 μg
Immunogen MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Storage Requirements Store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias DIABLO-S/FLJ10537/FLJ25049/SMAC/SMAC3
Common Name DIABLO
Gene Symbol DIABLO
Species Yeast
Recombinant Recombinant
Protein Tag None
Expression System Yeast expression system
Form Liquid
Purity or Quality Grade 0.9
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.