missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204561

Invitrogen™ Human DLL4 (aa 455-523) Control Fragment Recombinant Protein

Product Code. 30204561
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204561

Brand: Invitrogen™ RP93723

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Delta-like ligand 4 (DLL4), also know as Delta-4, is a homologue of the Drosophila delta protein, and functions as a transmembrane bound ligand to the notch receptor Notch1. DLL4 is expressed in the vasculature and plays a critical role in vascular development. It is induced by vascular endothelial growth factor (VEGF), as a negative feedback regulator to regulate angiogenic sprouting and promote the formulation of a differentiated vascular network. DLL4 has been found to be strongly expressed in tumor vessels of clear-cell renal tumors and bladder cancer, and inhibition of DLL4 results in increased vascular proliferation but defective maturation. This in turn leads to a decrease in tumor growth, with no apparent toxicity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NR61
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54567
Name Human DLL4 (aa 455-523) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AOS6; delta 4; delta ligand 4; delta like canonical Notch ligand 4; Delta4; delta-like 4 (Drosophila); delta-like 4 homolog; delta-like 4 protein; delta-like protein 4; DLL4; Drosophila Delta homolog 4; hdelta2; MGC126344; notch ligand delta-2; notch ligand DLL4; UNQ1895/PRO4341
Common Name DLL4
Gene Symbol Dll4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.