missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DRAK2 (aa 2-42) Control Fragment Recombinant Protein

Product Code. 30206249
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206249

Brand: Invitrogen™ RP109796

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145039 (PA5-145039. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STK17B (also known as DRAK2) is a member of the serine/threonine kinase family and is related to death-associated protein kinase that triggers apoptosis. STK17B is selectively important for T-cell survival and inhibition of STK17B has therapeutic potential for autoimmune disease. T-cell survival depends on a balance of T-cell receptor and co-stimulatory signals and deficiency of STK17B can affect autoimmune disease susceptibility without generalized suppression of the immune system. Protein kinases play important roles in the signal transduction in response to a variety of external stimuli. Recently, several protein kinases have been identified that may also be involved in apoptotic process. Overexpression of a serine/threonine kinase, ZIP kinase can cause the morphological changes typical of apoptosis in NIH 3T3 cells. Sanjo et al, have identified two new protein kinases DRAK1 and DRAK2 (Death Receptor Associated Kinase 1 and 2). Both DRAKs and ZIP kinase share significant homology at the amino acid level. The kinase domains of both DRAKs, ZIP kinase are homologous to DAP (Death-associated protein) kinase, which is involved in the apoptotic signaling induced by interferon-g. Overexpression of DRAKs in NIH 3T3 cells lead to apoptosis. These transfection experiments suggest that C-terminal domain of DRAKs are important for induction of apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O94768
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9262
Name Human DRAK2 (aa 2-42) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110009A03Rik; AI120141; DAP kinase-related apoptosis-inducing protein kinase 2; death-associated protein kinase-related 2; DRAK 2; DRAK2; serine/threonine kinase 17 b; serine/threonine kinase 17 b (apoptosis-inducing); serine/threonine-protein kinase 17 B; ST17B; STK 17 B; Stk17b
Common Name DRAK2
Gene Symbol STK17B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.