missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213108

Invitrogen™ Human DRIL1 (aa 354-480) Control Fragment Recombinant Protein

Product Code. 30213108
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30213108 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30213108 Supplier Invitrogen™ Supplier No. RP102503

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52106 (PA5-52106. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mouse Bright (B-cell regulator of IgH transcription) protein is expressed specifically in B cells and transactivates an IgH enhancer in transient transfection assays. Bright and the Drosophila 'dead ringer' (dri) gene product belong to a protein family whose members share a conserved DNA-binding domain termed the 'A/T-rich interaction domain' (ARID).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99856
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1820
Name Human DRIL1 (aa 354-480) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ARID domain-containing 3 A; ARID domain-containing protein 3 A; ARID3A; AT rich interactive domain 3 A (Bright like); AT rich interactive domain 3 A (BRIGHT- like) protein; AT rich interactive domain 3 A (BRIGHT-like); AT-rich interaction domain 3 A; AT-rich interactive domain-containing protein 3 A; B-cell regulator of IgH transcription; BRIGHT; dead ringer homolog 1; dead ringer-like 1; dead ringer-like protein 1; Dri1; DRIL1; DRIL3; DRX; E2F-binding protein 1; E2FBP1
Common Name DRIL1
Gene Symbol ARID3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.