missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206202

Invitrogen™ Human EED (aa 25-111) Control Fragment Recombinant Protein

Product Code. 30206202
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206202

Brand: Invitrogen™ RP105148

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84440 (PA5-84440. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The EED protein (WAIT-1 or WD protein associated with integrin cytoplasmic tails-1), also called embryonic ectoderm development, is a member of the superfamily of WD-40 repeat proteins and widely conserved polycomb group (PcG) family of proteins. The polycomb group (PcG) is a large and evolutionarily conserved set of genes whose products act in multimeric complexes to modify histones, which are then thought to cause stable and heritable states of transcriptional repression. EED shuttles between the nucleus and the plasma membrane and can interact with the cytoplasmic tail of integrin Beta-7 subunit. EED exerted an antiviral activity at the late stage of HIV-1 replication.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75530
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8726
Name Human EED (aa 25-111) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EED; embryonic ectoderm development; Embryonic ectoderm development protein; ENSMUSG00000039373; HEED; l(7)5 Rn; l7Rn5; lethal, Chr 7, Rinchik 5; lusk; Polycomb protein EED; WAIT1; WAIT-1; WD protein associating with integrin cytoplasmic tails 1
Common Name EED
Gene Symbol EED
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.