missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ELSPBP1 Control Fragment Recombinant Protein

Product Code. 30181092
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181092

Brand: Invitrogen™ RP99166

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60661 (PA5-60661. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ELSPBP1 (epididymal sperm-binding protein 1), also known as epididymal secretory protein 12 (E12), HE12 or EDDM12, is a 223 amino acid member of the seminal plasma protein family. ELSPBP1 is a secreted protein that is detected in cauda epididymal fluid and on sperm membrane. ELSPBP1 has phosphorylcholine-binding activity and has been shown to bind to spermatozoa upon ejaculation and is thought to play a role in sperm capacitation. N-glycosylated, ELSPBP1 contains four fibronectin type-II domains. The gene that encodes ELSPBP1 maps to human chromosome 19, which consists of over 63 million bases, houses approximately 1,400 genes and is recognized for having the greatest gene density of the human chromosomes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96BH3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64100
Name Human ELSPBP1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias E12; EDDM12; EL149; ELSPBP1; epididymal protein 12; epididymal secretory protein 12; epididymal sperm binding protein 1; epididymal sperm-binding protein 1; epididymis luminal secretory protein 149; ESPB1; hE12
Common Name ELSPBP1
Gene Symbol ELSPBP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SCISQGSFLGSLWWSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.