missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210078

Invitrogen™ Human EPPIN-WFDC6 (aa 21-56) Control Fragment Recombinant Protein

Product Code. 30210078
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210078

Brand: Invitrogen™ RP109127

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140325 (PA5-140325. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EPPIN-WFDC6 is a gene located on chromosome 20, resulting from read-through transcription between the SPINLW1 and WFDC6 genes. This gene encodes a fusion protein that exhibits functions related to both its parent genes. Structurally, EPPIN-WFDC6 includes elements from the WFDC6 gene, such as a WAP-type four-disulfide core domain, which is associated with antiprotease activity. This gene is notably expressed in the male reproductive system, particularly in the epididymis and seminal vesicles, where it plays a crucial role in sperm maturation and protection. EPPIN-WFDC6 is also involved in the regulation of proteolytic processes essential for reproductive function.
TRUSTED_SUSTAINABILITY

Specifications

Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 100526773
Name Human EPPIN-WFDC6 (aa 21-56) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Epididymal protease inhibitor; EPPIN; Semenogelin-binding protein; SPINLW1; WFDC6
Common Name EPPIN-WFDC6
Gene Symbol EPPIN-WFDC6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.